General Information

  • ID:  hor000688
  • Uniprot ID:  P01257
  • Protein name:  Calcitonin
  • Gene name:  Calca
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031716 calcitonin receptor binding; GO:0042802 identical protein binding; GO:0044877 protein-containing complex binding
  • GO BP:  GO:0001503 ossification; GO:0001935 endothelial cell proliferation; GO:0001944 vasculature development; GO:0001984 artery vasodilation involved in baroreceptor response to increased systemic arterial blood pressure; GO:0002031 G protein-coupled receptor internalization; GO:0002548 monocyte chemotaxis; GO:0006874 intracellular calcium ion homeostasis; GO:0006939 smooth muscle contraction; GO:0006954 inflammatory response; GO:0007155 cell adhesion; GO:0007159 leukocyte cell-cell adhesion; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0007566 embryo implantation; GO:0007631 feeding behavior; GO:0009408 response to heat; GO:0010523 negative regulation of calcium ion transport into cytosol; GO:0030279 negative regulation of ossification; GO:0031623 receptor internalization; GO:0032730 positive regulation of interleukin-1 alpha production; GO:0032757 positive regulation of interleukin-8 production; GO:0042311 vasodilation; GO:0043542 endothelial cell migration; GO:0045651 positive regulation of macrophage differentiation; GO:0045671 negative regulation of osteoclast differentiation; GO:0045776 negative regulation of blood pressure; GO:0045779 negative regulation of bone resorption; GO:0045785 positive regulation of cell adhesion; GO:0045892 negative regulation of DNA-templated transcription; GO:0045986 negative regulation of smooth muscle contraction; GO:0048265 response to pain; GO:0050965 detection of temperature stimulus involved in sensory perception of pain; GO:0051480 regulation of cytosolic calcium ion concentration; GO:0071356 cellular response to tumor necrosis factor; GO:1990090 cellular response to nerve growth fact
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0030424 axon; GO:0043005 neuron projection; GO:0043025 neuronal cell body; GO:0043195 terminal bouton; GO:0098686 hippocampal mossy fiber to CA3 synapse; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP
  • Length:  32
  • Propeptide:  MGFLKFSPFLVVSILLLYQACGLQAVPLRSTLESSPGMATLSEEEARLLAALVQNYMQMKVRELEQEEEQEAEGSSLDSPRSKRCGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAPGKKRDMAKDLETNHHPYFGN
  • Signal peptide:  MGFLKFSPFLVVSILLLYQACGLQA
  • Modification:  T32 Proline amide
  • Glycosylation:  T3 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Causes a rapid but short-lived drop in the level of calcium and phosphate in blood
  • Mechanism:  Promot the incorporation of those ions in the bones.
  • Cross BBB:  NA
  • Target:  Calcr, Calcrl
  • Target Unid:  P32214, Q63118
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  1-7
  • Structure ID:  AF-P01257-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000688_AF2.pdbhor000688_ESM.pdb

Physical Information

Mass: 395599 Formula: C148H229N39O47S3
Absent amino acids: ERW Common amino acids: T
pI: 7.25 Basic residues: 2
Polar residues: 16 Hydrophobic residues: 8
Hydrophobicity: -4.38 Boman Index: -2292
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 60.94
Instability Index: 3722.81 Extinction Coefficient cystines: 1615
Absorbance 280nm: 52.1

Literature

  • PubMed ID:  1278175
  • Title:  The Complete Amino-Acid Sequence of Rat Thyrocalcitonin